Allergen

QID21357.1

Accession QID21357.1
Species Populus nigra
Common Name black poplar
Description profilin
IUIS Name Pop n 2
Gi
Length 131
Year Adopted 2022
Sequence >QID21357.1 Allergen Pop n 2; profilin [Populus nigra]
MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL
APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE
RLGDYLIDQGL
Parent Accession