Allergen

QIJ32297.1

Accession QIJ32297.1
Species Crassostrea angulata
Common Name Portuguese oyster
Description calcium-binding protein, sarcoplasmic calcium-binding protein
IUIS Name Cra a 4
Gi
Length 179
Year Adopted 2021
Sequence >QIJ32297.1 Allergen Cra a 4; calcium-binding protein, sarcoplasmic calcium-binding protein [Crassostrea angulata]
MDYLNKKWKIWYNSLDVNHDGKISIEDVEESRNKFTNLHELVGDKAKGVQVNFEDWWN
KYIFRTGAGKEISESEFVQQLTEAYKKDKVGFIKEMQACFDCIFDVIDTNKDRTIDED
EFVYAFKAFGHENEALVRKAFSLYNKENKHVPLKDIVSEWVKFVTEEDTGKKDIIMEA
FKEGF
Parent Accession