Allergen

QOI58528.1

Accession QOI58528.1
Species Tyrophagus putrescentiae
Common Name storage mite
Description arginine kinase
IUIS Name Tyr p 20
Gi
Length 357
Year Adopted 2022
Sequence >QOI58528.1 Allergen Tyr p 20; arginine kinase [Tyrophagus putrescentiae]
MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTGMGATLLDVIQSGVE
NLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNEF
VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQQ
QLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDL
KEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE
VAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL
Parent Accession