Allergen

QUJ17885.1

Accession QUJ17885.1
External DB Link NCBI Protein
Species Apium graveolens
Common Name celery
Description defensin
IUIS Name Api g 7
Length 93
Year Adopted 2023
Sequence >QUJ17885.1 Api g 7; defensin [Apium graveolens]
MAPKASSLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTK
NCDNQCIQWETARHGACHKRGGKWMCFCYFDRC
Parent Accession

Related Articles

Pubmed Authors Title Journal
34908171 Wangorsch, A., Lidholm, J., Mattsson, L. A., Larsson, H., Reuter, A., Gubesch, M., Gadermaier, G., Bures, P., Scheurer, S., Ballmer-Weber, B. and Vieths, S. Identification of a defensin as novel allergen in celery root: Api g 7 as a missing link in the diagnosis of celery allergy? Allergy. 2022 Apr; 77(4):1294-1296.