Allergen

S0BDX9

Accession S0BDX9
Species Cavia porcellus
Common Name domestic guinea pig
Description lipocalin
IUIS Name Cav p 6
Gi
Length 181
Year Adopted 2022
Sequence >S0BDX9 Allergen Cav p 6; lipocalin [Cavia porcellus]
MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVE
SIEPVKDSALSFKFWAHENGECKQISLICNRVAEGVYAVEYDGYNVFRVAETDYKNYAIF
QLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQARGE
K
Parent Accession