Allergen

XP_030492464

Accession XP_030492464
Species Cannabis sativa
Common Name hemp
Description profilin
IUIS Name Can s 2
Gi
Length 133
Year Adopted 2022
Sequence >XP_030492464 Allergen Can s 2; profilin [Cannabis sativa]
MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG
HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV
VERLGDYLVDQGL
Parent Accession