Allergen

XP_046915420.1

Accession XP_046915420.1
External DB Link NCBI Protein
Species Dermatophagoides farinae
Common Name house dust mite
Description thioredoxin
IUIS Name Der f 40
Length 106
Year Adopted 2026
Sequence >XP_046915420.1 Der f 40; thioredoxin [Dermatophagoides farinae]
MVHKVTDKDDMKKQLKDAGDKLVVVDFYATWCGPCRLIAPVLEKLAEENKEKLVVLKVDV
DENEELTSEYGITSMPTFVLIKNEQKVHSFSGASEPKLREAIQQYS
Parent Accession

Related Articles

Pubmed Authors Title Journal
37577028 Cai, ZL; Liu, S; Li, WY; Zhou, ZW; Hu, WZ; Chen, JJ; Ji, K Identification of an immunodominant IgE epitope of Der f 40, a novel allergen of Dermatophagoides farinae World Allergy Organ J. 2023 Aug;16