CakePHP: the rapid development php framework: Allergens

Allergens

Id	Species	Common Name	Definition	Accession	Length	Reference	Year Adopted	Sequence	Header	Actions
2,462	Gallus gallus	chicken	aldolase, partial	COMPARE00295	57	20803	2022	PHQYPALTPEQKKELHDIAKRIVAPGKGILAADESTGSIAKRLSSVGAENTEENRRW	>COMPARE00295 Gal d 10; aldolase, partial [Gallus gallus]	View Edit Delete
2,463	Gallus gallus	chicken	aldolase, partial	COMPARE00296	32	20803	2022	RVDPCIGGVILFHETLYQKADDGRPFPQVIKS	>COMPARE00296 Gal d 10; aldolase, partial [Gallus gallus]	View Edit Delete
2,464	Gallus gallus	chicken	aldolase, partial	COMPARE00297	28	20803	2022	KVDKGVVPLAGTNGETTTQGLDGLMERC	>COMPARE00297 Gal d 10; aldolase, partial [Gallus gallus]	View Edit Delete
2,465	Gallus gallus	chicken	aldolase, partial	COMPARE00298	63	20803	2022	KKDGADFAKWRCVLKISEHTPTRLAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKH	>COMPARE00298 Gal d 10; aldolase, partial [Gallus gallus]	View Edit Delete
2,466	Gallus gallus	chicken	aldolase, partial	COMPARE00299	19	20803	2022	KKYSPEEIAMATVTALRRT	>COMPARE00299 Gal d 10; aldolase, partial [Gallus gallus]	View Edit Delete
2,467	Gallus gallus	chicken	aldolase, partial	COMPARE00300	15	20803	2022	RALQASALRAWAGKK	>COMPARE00300 Gal d 10; aldolase, partial [Gallus gallus]	View Edit Delete
2,468	Gallus gallus	chicken	aldolase, partial	COMPARE00301	11	20803	2022	KAAQEEYVKRA	>COMPARE00301 Gal d 10; aldolase, partial [Gallus gallus]	View Edit Delete
2,469	Vespa velutina	Asian hornet	phospholipase A1, partial from C0HLL3.1	COMPARE00302	13	21081, 21082	2022	LVPEQISFILSTR	>COMPARE00302 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina]	View Edit Delete
2,470	Vespa velutina	Asian hornet	phospholipase A1, partial from C0HLL3.1	COMPARE00303	18	21081, 21082	2022	NGVFLTLDSLKKGGILNK	>COMPARE00303 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina]	View Edit Delete
2,471	Vespa velutina	Asian hornet	phospholipase A1, partial from C0HLL3.1	COMPARE00304	40	21081, 21082	2022	ALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTR	>COMPARE00304 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina]	View Edit Delete
2,472	Vespa velutina	Asian hornet	phospholipase A1, partial from C0HLL3.1	COMPARE00305	12	21081, 21082	2022	YIADFSKLLMQK	>COMPARE00305 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina]	View Edit Delete
2,473	Vespa velutina	Asian hornet	phospholipase A1, partial from C0HLL3.1	COMPARE00306	16	21081, 21082	2022	LIGHSLGAQIAGFAGK	>COMPARE00306 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina]	View Edit Delete
2,474	Vespa velutina	Asian hornet	phospholipase A1, partial from C0HLL3.1	COMPARE00307	18	21081, 21082	2022	LGKYPEIIGLDPAGPLFK	>COMPARE00307 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina]	View Edit Delete
2,475	Vespa velutina	Asian hornet	phospholipase A1, partial from C0HLL3.1	COMPARE00308	22	21081, 21082	2022	ICETDAHYVQIIHTSNNLGTER	>COMPARE00308 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina]	View Edit Delete
2,476	Vespa velutina	Asian hornet	phospholipase A1, partial from C0HLL3.1	COMPARE00309	22	21081, 21082	2022	AVQYFTECIRHECCLIGVPQSK	>COMPARE00309 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina]	View Edit Delete
2,477	Vespa velutina	Asian hornet	phospholipase A1, partial from C0HLL3.1	COMPARE00310	36	21081, 21082	2022	CTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNK	>COMPARE00310 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina]	View Edit Delete
2,478	Vespa velutina	Asian hornet	unknown function, antigen 5, partial from P0DMB9.2	COMPARE00311	19	21081, 21082	2022	SGIHTLCKYGTSTKPNCGR	>COMPARE00311 Vesp v 5; unknown function, antigen 5, partial from P0DMB9.2 [Vespa velutina]	View Edit Delete
2,479	Vespa velutina	Asian hornet	unknown function, antigen 5, partial from P0DMB9.2	COMPARE00312	14	21081, 21082	2022	AEKLEILKQHNEFR	>COMPARE00312 Vesp v 5; unknown function, antigen 5, partial from P0DMB9.2 [Vespa velutina]	View Edit Delete
2,480	Vespa velutina	Asian hornet	unknown function, antigen 5, partial from P0DMB9.2	COMPARE00313	38	21081, 21082	2022	GLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCK	>COMPARE00313 Vesp v 5; unknown function, antigen 5, partial from P0DMB9.2 [Vespa velutina]	View Edit Delete
2,481	Vespa velutina	Asian hornet	unknown function, antigen 5, partial from P0DMB9.2	COMPARE00314	100	21081, 21082	2022	NTAKYLVGQNIAEQSTTAASFEPVSNMVKMWSDEVKDYQYGSSKNKLNDVGHYTQMVWAK TKEIGCGNIKYIENGWHHHYLVCNYGPAGNIGNEPIYEKK	>COMPARE00314 Vesp v 5; unknown function, antigen 5, partial from P0DMB9.2 [Vespa velutina]	View Edit Delete

Page 124 of 146, showing 20 record(s) out of 2,914 total