Allergens

Id Species Common Name Definition Gi Accession Length Reference Year Adopted Sequence Header Actions
2,462 Gallus gallus chicken aldolase, partial COMPARE00295 57 20803 2022 PHQYPALTPEQKKELHDIAKRIVAPGKGILAADESTGSIAKRLSSVGAENTEENRRW >COMPARE00295 Gal d 10; aldolase, partial [Gallus gallus] View Edit
Delete
2,463 Gallus gallus chicken aldolase, partial COMPARE00296 32 20803 2022 RVDPCIGGVILFHETLYQKADDGRPFPQVIKS >COMPARE00296 Gal d 10; aldolase, partial [Gallus gallus] View Edit
Delete
2,464 Gallus gallus chicken aldolase, partial COMPARE00297 28 20803 2022 KVDKGVVPLAGTNGETTTQGLDGLMERC >COMPARE00297 Gal d 10; aldolase, partial [Gallus gallus] View Edit
Delete
2,465 Gallus gallus chicken aldolase, partial COMPARE00298 63 20803 2022 KKDGADFAKWRCVLKISEHTPTRLAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKH >COMPARE00298 Gal d 10; aldolase, partial [Gallus gallus] View Edit
Delete
2,466 Gallus gallus chicken aldolase, partial COMPARE00299 19 20803 2022 KKYSPEEIAMATVTALRRT >COMPARE00299 Gal d 10; aldolase, partial [Gallus gallus] View Edit
Delete
2,467 Gallus gallus chicken aldolase, partial COMPARE00300 15 20803 2022 RALQASALRAWAGKK >COMPARE00300 Gal d 10; aldolase, partial [Gallus gallus] View Edit
Delete
2,468 Gallus gallus chicken aldolase, partial COMPARE00301 11 20803 2022 KAAQEEYVKRA >COMPARE00301 Gal d 10; aldolase, partial [Gallus gallus] View Edit
Delete
2,469 Vespa velutina Asian hornet phospholipase A1, partial from C0HLL3.1 COMPARE00302 13 21081, 21082 2022 LVPEQISFILSTR >COMPARE00302 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] View Edit
Delete
2,470 Vespa velutina Asian hornet phospholipase A1, partial from C0HLL3.1 COMPARE00303 18 21081, 21082 2022 NGVFLTLDSLKKGGILNK >COMPARE00303 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] View Edit
Delete
2,471 Vespa velutina Asian hornet phospholipase A1, partial from C0HLL3.1 COMPARE00304 40 21081, 21082 2022 ALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTR >COMPARE00304 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] View Edit
Delete
2,472 Vespa velutina Asian hornet phospholipase A1, partial from C0HLL3.1 COMPARE00305 12 21081, 21082 2022 YIADFSKLLMQK >COMPARE00305 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] View Edit
Delete
2,473 Vespa velutina Asian hornet phospholipase A1, partial from C0HLL3.1 COMPARE00306 16 21081, 21082 2022 LIGHSLGAQIAGFAGK >COMPARE00306 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] View Edit
Delete
2,474 Vespa velutina Asian hornet phospholipase A1, partial from C0HLL3.1 COMPARE00307 18 21081, 21082 2022 LGKYPEIIGLDPAGPLFK >COMPARE00307 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] View Edit
Delete
2,475 Vespa velutina Asian hornet phospholipase A1, partial from C0HLL3.1 COMPARE00308 22 21081, 21082 2022 ICETDAHYVQIIHTSNNLGTER >COMPARE00308 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] View Edit
Delete
2,476 Vespa velutina Asian hornet phospholipase A1, partial from C0HLL3.1 COMPARE00309 22 21081, 21082 2022 AVQYFTECIRHECCLIGVPQSK >COMPARE00309 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] View Edit
Delete
2,477 Vespa velutina Asian hornet phospholipase A1, partial from C0HLL3.1 COMPARE00310 36 21081, 21082 2022 CTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNK >COMPARE00310 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] View Edit
Delete
2,478 Vespa velutina Asian hornet unknown function, antigen 5, partial from P0DMB9.2 COMPARE00311 19 21081, 21082 2022 SGIHTLCKYGTSTKPNCGR >COMPARE00311 Vesp v 5; unknown function, antigen 5, partial from P0DMB9.2 [Vespa velutina] View Edit
Delete
2,479 Vespa velutina Asian hornet unknown function, antigen 5, partial from P0DMB9.2 COMPARE00312 14 21081, 21082 2022 AEKLEILKQHNEFR >COMPARE00312 Vesp v 5; unknown function, antigen 5, partial from P0DMB9.2 [Vespa velutina] View Edit
Delete
2,480 Vespa velutina Asian hornet unknown function, antigen 5, partial from P0DMB9.2 COMPARE00313 38 21081, 21082 2022 GLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCK >COMPARE00313 Vesp v 5; unknown function, antigen 5, partial from P0DMB9.2 [Vespa velutina] View Edit
Delete
2,481 Vespa velutina Asian hornet unknown function, antigen 5, partial from P0DMB9.2 COMPARE00314 100 21081, 21082 2022 NTAKYLVGQNIAEQSTTAASFEPVSNMVKMWSDEVKDYQYGSSKNKLNDVGHYTQMVWAK TKEIGCGNIKYIENGWHHHYLVCNYGPAGNIGNEPIYEKK >COMPARE00314 Vesp v 5; unknown function, antigen 5, partial from P0DMB9.2 [Vespa velutina] View Edit
Delete

Page 124 of 149, showing 20 record(s) out of 2,977 total