Allergens

Id Species Common Name Definition Gi Accession Length Reference Year Adopted Sequence Header Actions
3,683 Zanthoxylum bungeanum Sichuan pepper 11S globulin, cupin, partial COMPARE00960 15 21172 2025 GLPLDVIQNSFQVSR >COMPARE00960 Zan b 2; 11S globulin, cupin, partial [Zanthoxylum bungeanum] View Edit
Delete
3,684 Zanthoxylum bungeanum Sichuan pepper 11S globulin, cupin, partial COMPARE00953 27 21172 2025 VESEAGVTEFWDQNDDQLQCANVAVFR >COMPARE00953 Zan b 2; 11S globulin, cupin, partial [Zanthoxylum bungeanum] View Edit
Delete
3,685 Zanthoxylum bungeanum Sichuan pepper 11S globulin, cupin, partial COMPARE00954 27 21172 2025 VESEAGVTEFWDQNNEQLQCANVAVFR >COMPARE00954 Zan b 2; 11S globulin, cupin, partial [Zanthoxylum bungeanum] View Edit
Delete
3,686 Zanthoxylum bungeanum Sichuan pepper 11S globulin, cupin, partial COMPARE00950 25 21172 2025 ARGSEFEWISFKTNDNAMISPLSGR >COMPARE00950 11S globulin, cupin, partial [Zanthoxylum bungeanum] View Edit
Delete
3,687 Zanthoxylum bungeanum Sichuan pepper 11S globulin, cupin, partial COMPARE00958 16 21172 2025 FQTQCNIQNLNALEPR >COMPARE00958 Zan b 2; 11S globulin, cupin, partial [Zanthoxylum bungeanum] View Edit
Delete
3,688 Zanthoxylum bungeanum Sichuan pepper 11S globulin, cupin, partial COMPARE00961 23 21172 2025 GSEFEWISFKTNDNAMISPLSGR >COMPARE00961 Zan b 2; 11S globulin, cupin, partial [Zanthoxylum bungeanum] View Edit
Delete
3,689 Zanthoxylum bungeanum Sichuan pepper 11S globulin, cupin, partial COMPARE00951 10 21172 2025 LRENIGDPSK >COMPARE00951 Zan b 2; 11S globulin, cupin, partial [Zanthoxylum bungeanum] View Edit
Delete
3,690 Zanthoxylum bungeanum Sichuan pepper 11S globulin, cupin, partial COMPARE00952 13 21172 2025 TNDNAMISPLSGR >COMPARE00952 11S globulin, cupin, partial [Zanthoxylum bungeanum] View Edit
Delete
3,691 Zanthoxylum bungeanum Sichuan pepper 11S globulin, cupin, partial from QYS16039.1 COMPARE00955 12 21172 2025 ASNRGLEWISFK >COMPARE00955 Zan b 2; 11S globulin, cupin, partial from QYS16039.1 [Zanthoxylum bungeanum] View Edit
Delete
3,692 Zanthoxylum bungeanum Sichuan pepper 11S globulin, cupin, partial from QYS16039.1 COMPARE00956 16 21172 2025 EGQLIVVPQGFAVVKR >COMPARE00956 Zan b 2; 11S globulin, cupin, partial from QYS16039.1 [Zanthoxylum bungeanum] View Edit
Delete
3,693 Zanthoxylum bungeanum Sichuan pepper 11S globulin, cupin, partial COMPARE00959 20 21172 2025 GLLVPAYTNTPEIFYVVQGR >COMPARE00959 Zan b 2; 11S globulin, cupin, partial [Zanthoxylum bungeanum] View Edit
Delete
3,694 Zanthoxylum bungeanum Sichuan pepper 11S globulin, cupin, partial COMPARE00962 11 21172 2025 ILAEAFNVDER >COMPARE00962 Zan b 2; 11S globulin, cupin, partial [Zanthoxylum bungeanum] View Edit
Delete
3,695 Betula platyphylla Asian white birch pectin esterase, partial COMPARE00964 11 21164 2025 REGVYEETVRV >COMPARE00964 pectin esterase, partial [Betula platyphylla] View Edit
Delete
3,696 Prunus persica peach mandelonitrile lyase, partial from A0A251QUN8 COMPARE00966 32 21167 2025 GTIATEYPNTLTADGFAYNLQQQDDGKTPVER >COMPARE00966 mandelonitrile lyase, partial from A0A251QUN8 [Prunus persica] View Edit
Delete

Page 146 of 146, showing 14 record(s) out of 2,914 total