Article
Isolation and nucleotide sequence of a cDNA-clone encoding the bread wheat (Triticum aestivum L.) CM17 protein
| Id | 1017 |
|---|---|
| Pubmed | 1932681 |
Authors
Lullien,V.; Alary,R.; Guirao,A.; Joudrier,P.; Gautier,M.F.
Title
Isolation and nucleotide sequence of a cDNA-clone encoding the bread wheat (Triticum aestivum L.) CM17 protein
Journal
Plant Mol. Biol. 170, 1081-1082 (1991)
Pubmed ID
1932681Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 95 | Triticum aestivum | wheat | alpha-amylase inhibitor | 0000021711 | CAA42453.1 | 143 | 167, 1017, 1437, 2234 | 2007 | MASKSNYNLLFTALLVFIFAAVAAVGNEDCTPWTSTLITPLPSCRNYVEEQACRIEMPGP PYLAKQECCEQLANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMNFVPILVTP GYCNLTTVHNTPYCLGMEESQWS | >CAA42453.1 Tri a 40; alpha-amylase inhibitor [Triticum aestivum] | View Edit Delete |
| 107 | Triticum turgidum | wheat | alpha-amlyase inhibitor | 0000021916 | CAA34709.1 | 143 | 167, 1017, 1437, 2234 | 2007 | MASKSNCVLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPGS PYLAKQQCCGELANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMDFVRILVTP GYCNLTTVHNTPYCLAMEESQWS | >CAA34709.1 alpha-amlyase inhibitor [Triticum turgidum] | View Edit Delete |
| 1605 | Triticum aestivum | wheat | alpha-amylase inhibitor | 0195957140 | ACG59281.1 | 143 | 167, 1017, 1437, 2234 | 2010 | MASESNCVLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPGS PYLAKQQCCGELANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMDFVRILVTP GYCNLTTVHNTPYCLAMEESQWS | >ACG59281.1 Tri a 40; alpha-amylase inhibitor [Triticum aestivum] | View Edit Delete |