Article
Nucleotide sequence analysis of a complementary DNA coding for a Blomia tropicalis allergen
| Id | 1161 |
|---|---|
| Pubmed | 8939156 |
Authors
Puerta,L.; Caraballo,L.; Fernandez-Caldas,E.; Avjioglu,A.; Marsh,D.G.; Lockey,R.F.; Dao,M.L.
Title
Nucleotide sequence analysis of a complementary DNA coding for a Blomia tropicalis allergen
Journal
J. Allergy Clin. Immunol. 98 (5 Pt 1), 932-937 (1996)
Pubmed ID
8939156Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 349 | Blomia tropicalis | house dust mite | chitin-binding protein | 0000902012 | AAA78904.1 | 144 | 1161, 4505, 19524, 20169 | 2007 | MKSVLIFLVAIALFSANIVSADEQTTRGRHTEPDDHHEKPTTQCTHEETTSTQHHHEEVV TTQTPHHEEKTTTEETHHSDDLIVHEGGKTYHVVCHEEGPIHIQEMCNKYIICSKSGSLW YITVMPCSIGTKFDPISRNCVLDN | >AAA78904.1 Blo t 12; chitin-binding protein [Blomia tropicalis] | View Edit Delete |
| 1057 | Lepidoglyphus destructor | storage mite | unknown function | 0033943777 | AAQ55550.1 | 143 | 1161, 4505, 19524, 20169 | 2007 | MKSVLIFLVAIALFSANIVSADEQTTRGRHTEPDDHHEKPTTHATHEETTSTQHHHEEVT TQTPHHEEKTTTEETHHSDDLIVHEGGKTYHVVCHEEGPIPHPGNVHKYIICSKSGSLWY ITVMPCSIGTKFDPISRNCVLDN | >AAQ55550.1 unknown function [Lepidoglyphus destructor] | View Edit Delete |
| 2008 | Blomia tropicalis | house dust mite | chitin-binding protein, partial | 0723586656 | 2MFK_A | 69 | 1161, 4505, 19524, 20169 | 2016 | GPLGSDLIVHEGGKTYHVVCHEEGPIPHPGNVHKYIICSKSGSLWYITVMPCSIGTKFDP ISRNCVLDN | >2MFK_A Blo t 12; chitin-binding protein, partial [Blomia tropicalis] | View Edit Delete |