Article
Nucleotide sequence of a cDNA clone encoding the wheat (Triticum durum Desf.) CM2 protein
| Id | 1166 |
|---|---|
| Pubmed | 1893104 |
Authors
Gautier,M.F.; Alary,R.; Lullien,V.; Joudrier,P.
Title
Nucleotide sequence of a cDNA clone encoding the wheat (Triticum durum Desf.) CM2 protein
Journal
Plant Mol. Biol. 16 (2), 333-334 (1991)
Pubmed ID
1893104Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 94 | Triticum aestivum | wheat | alpha-amylase inhibitor | 0000021701 | CAA35598.1 | 145 | 243, 1166, 2234 | 2007 | MASKSSISPLLLATVLVSVFAAATATGPYCYAGMGLPINPLEGCREYVAQQTCGISISGS AVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFA KVLVTSGHCNVMTVHNAPYCLGLDI | >CAA35598.1 Tri a 29; alpha-amylase inhibitor [Triticum aestivum] | View Edit Delete |
| 108 | Triticum turgidum | wheat | alpha-amlyase inhibitor | 0000021920 | CAA39099.1 | 145 | 243, 1166, 2234 | 2007 | MASKSSITHLLLAAVLVSVFAAAAATGPYCYPGMGLPSNPLEGCREYVAQQTCGVGIVGS PVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRTSDPNSGVLKDLPGCPREPQRDFA KVLVTPGHCNVMTVHNTPYCLGLDI | >CAA39099.1 alpha-amlyase inhibitor [Triticum turgidum] | View Edit Delete |
| 1684 | Triticum aestivum | wheat | alpha-amylase inhibitor | 0253783731 | CAZ76052.1 | 120 | 243, 1166, 2234 | 2011 | TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLDI | >CAZ76052.1 Tri a 29; alpha-amylase inhibitor [Triticum aestivum] | View Edit Delete |
| 1702 | Triticum aestivum | wheat | alpha-amylase inhibitor | 0283465827 | CBA13559.1 | 120 | 243, 1166, 2234 | 2011 | TGPYCYPGMGLPSNPLEGCREYVAQQTCGVGIVGSPVSTEPGNTPRDRCCKELYDASQHC WCEAVRYFIGRTSDPNSGVLKDLPGCPREPQRDSAKVLVTPGHCNVMTVHNTPYCLGLDI | >CBA13559.1 Tri a 29; alpha-amylase inhibitor [Triticum aestivum] | View Edit Delete |