Article
Der p 5 crystal structure provides insight into the group 5 dust mite allergens
| Id | 15149 |
|---|---|
| Pubmed | 20534590 |
Authors
Mueller,G.A.; Gosavi,R.A.; Krahn,J.M.; Edwards,L.L.; Cuneo,M.J.; Glesner,J.; Pomes,A.; Chapman,M.D.; London,R.E.; Pedersen,L.C.;
Title
Der p 5 crystal structure provides insight into the group 5 dust mite allergens
Journal
J. Biol. Chem. 285 (33), 25394-25401 (2010)
Pubmed ID
20534590Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 72 | Dermatophagoides pteronyssinus | house dust mite | unknown function | 0000009072 | CAA35692.1 | 148 | 146, 222, 2511, 7687, 7750, 15149 | 2015 | LFLENKDPKPLKKISIMKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKK GELALFYLQEQINHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQY NLEMAKKSGDILERDLKKEEARVKKIEV | >CAA35692.1 Der p 5; unknown function [Dermatophagoides pteronyssinus] | View Edit Delete |
| 350 | Dermatophagoides pteronyssinus | house dust mite | unknown function | 0000913285 | AAB32842.1 | 132 | 146, 222, 2511, 7687, 7750, 15149 | 2007 | MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFE AKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDL KKEEARVKKIEV | >AAB32842.1 Der p 5; unknown function [Dermatophagoides pteronyssinus] | View Edit Delete |
| 997 | Dermatophagoides pteronyssinus | house dust mite | unknown function | 0028798085 | CAD69036.1 | 132 | 146, 222, 2511, 7687, 7750, 15149 | 2007 | MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFE EKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMLKKSGDILERDL KKEEARVKNIEV | >CAD69036.1 Der p 5; unknown function [Dermatophagoides pteronyssinus] | View Edit Delete |