Article
Anisakis simplex Hypersensitivity Is Associated with Chronic Urticaria in Endemic Areas.
| Id | 19175 |
|---|---|
| Pubmed | 23095317 |
Authors
Ventura MT; Napolitano S; Menga R; Cecere R; Asero R
Title
Anisakis simplex Hypersensitivity Is Associated with Chronic Urticaria in Endemic Areas.
Journal
Int Arch Allergy Immunol. 2012 Oct 18;160(3):297-300
Pubmed ID
23095317Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 1136 | Anisakis simplex | parasitic fish worm | serine protease inhibitor | 0047605452 | Q7Z1K3.1 | 194 | 2072, 2073, 4544, 19175, 19176, 19177, 19425, 19426, 19427 | 2007 | MASMQHFSLAALLLAASICLGDADRTECQLPLDKGTPCTQEGGVKPSVAWWHDDKSGICL SFKYTGCGGNANRFTTIKNCEQHCKMPDRGACALGKKPAEDSNGEQLVCAGMREDKCPNG YQCKMMAFMGLCCPTKEEELFAREYEGVCKSGKPVKMDRGSGWMMTILGKSCDDQFCPED AKCERGKLFANCCK | >Q7Z1K3.1 Ani s 1; serine protease inhibitor [Anisakis simplex] | View Edit Delete |
| 1913 | Anisakis simplex | parasitic fish worm | serine protease inhibitor | 0442577863 | AGC60035.1 | 163 | 2072, 2073, 4544, 19175, 19176, 19177, 19425, 19426, 19427 | 2014 | MDKGTPCTQEGGVKPSVAWWHDDKTGICLSFKYTGCGGNANRFTTIKNCEQHCKMPDRGA CALGKKPAEDSNGEQLVCAGMREDKCPNGYQCKMMAFMGLCCPTKEEELFAREYEGVCKS GKPVKMDRGSGWMMTILGKSCDDQFCPEDAKCEQGKLFANCCK | >AGC60035.1 Ani s 1; serine protease inhibitor [Anisakis simplex] | View Edit Delete |
| 1914 | Anisakis simplex | parasitic fish worm | serine protease inhibitor | 0442577865 | AGC60036.1 | 163 | 2072, 2073, 4544, 19175, 19176, 19177, 19425, 19426, 19427 | 2014 | MDKGTPCTQEGGVKPSVAWWHDDKSGICLSFKYTGCGGNANRFTTIKNCEQHCKMPDRGA CALGKKPAEDSNGEQLVCAGMREDKCPNGYQCKMMAFMGLCCPTKEEELFAREYEGVCKS GKPVKMDRGSGWMMTILGKSCDDQFCPEDAKCEQGKLFANCCK | >AGC60036.1 Ani s 1; serine protease inhibitor [Anisakis simplex] | View Edit Delete |