Article
Crystal structure of peanut (Arachis hypogaea) allergen Ara h 5
| Id | 19213 |
|---|---|
| Pubmed | 23350842 |
Authors
Wang,Y.; Fu,T.J.; Howard,A.; Kothary,M.H.; McHugh,T.H.; Zhang,Y.Z.;
Title
Crystal structure of peanut (Arachis hypogaea) allergen Ara h 5
Journal
J. Agric. Food Chem. (2013) In press
Pubmed ID
23350842Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 704 | Arachis hypogaea | peanut | profilin | 0005902968 | AAD55587.1 | 131 | 1269, 12911, 19213 | 2007 | MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE RLGDYLIDTGL | >AAD55587.1 Ara h 5; profilin [Arachis hypogaea] | View Edit Delete |
| 1708 | Arachis hypogaea | peanut | profilin | 0284810529 | ADB96066.1 | 131 | 1269, 12911, 19213 | 2011 | MSWQTYVDNHLLCEIEGNHLSSAAILGQDGSVWAQSSNFPQFKPEEITAIMNDFAEPGSL APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTNQALIIGIYDEPMTPGQCNMIVE RLGDYLIDTGL | >ADB96066.1 Ara h 5; profilin [Arachis hypogaea] | View Edit Delete |
| 1889 | Arachis hypogaea | peanut | profilin | 0431812555 | AGA84056.1 | 131 | 1269, 12911, 19213 | 2014 | MSWQTYVDDHLLCEIEGNHLSSAAILGQDGSVWAQSSNFPQFKPEEITAIMNDFAEPGSL APTGLYLGGTKYMVIQGEPGTVIRGKKGPGGVTIKKTNQALIIGIYDEPMTPGQCNMIVE KLGDYLIDTGL | >AGA84056.1 Ara h 5; profilin [Arachis hypogaea] | View Edit Delete |