Article
Cloning and expression of recombinant Aspergillus fumigatus allergen I/a (rAsp f I/a) with IgE binding and type I skin test activity
| Id | 198 |
|---|---|
| Pubmed | 1624793 |
Authors
Moser,M.; Crameri,R.; Menz,G.; Schneider,T.; Dudler,T.; Virchow,C.; Gmachl,M.; Blaser,K.; Suter,M.
Title
Cloning and expression of recombinant Aspergillus fumigatus allergen I/a (rAsp f I/a) with IgE binding and type I skin test activity
Journal
J. Immunol. 149 (2), 454-460 (1992)
Pubmed ID
1624793Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 578 | Aspergillus fumigatus | fungus | ribonuclease mitogillin, partial | 0003021324 | CAA06305.1 | 125 | 75, 198, 887, 1270, 2118, 4496, 19419 | 2007 | RLVYNQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGDGKLIKGRMPIKFGKADCDRPPK HGKDGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHERGN QGDLR | >CAA06305.1 Asp f 1; ribonuclease mitogillin, partial [Aspergillus fumigatus] | View Edit Delete |
| 757 | Aspergillus fumigatus | fungus | ribonuclease mitogillin | 0009280360 | AAF86369.1 | 150 | 75, 198, 887, 1270, 2118, 4496, 19419 | 2007 | MTWTCINQQLNPKTNKWEDKRLLYNQAKAESNSHHAPLSDGKTGSSYAHWFTNGYDGNGK LIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKNKPKEDPGPA RVIYTYPNKVFCGIVAHQRGNEGDLRLCSH | >AAF86369.1 Asp f 1; ribonuclease mitogillin [Aspergillus fumigatus] | View Edit Delete |
| 1164 | Aspergillus fumigatus | fungus | ribonuclease mitogillin | 0054039254 | P67875.1 | 176 | 75, 198, 887, 1270, 2118, 4496, 19419 | 2007 | MVAIKNLFLLAATAVSVLAAPSPLDARATWTCINQQLNPKTNKWEDKRLLYSQAKAESNS HHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYL LEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH | >P67875.1 Asp f 1; ribonuclease mitogillin [Aspergillus fumigatus] | View Edit Delete |