Article
Culture of Blomia tropicalis and IgE immunoblot characterization of its allergenicity.
| Id | 20169 |
|---|---|
| Pubmed | 10697258 |
Authors
Yi FC; Chew FT; Jimenez S; Chua KY; Lee BW
Title
Culture of Blomia tropicalis and IgE immunoblot characterization of its allergenicity.
Journal
Asian Pac J Allergy Immunol. 1999 Sep;17(3):189-94
Pubmed ID
10697258Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 349 | Blomia tropicalis | house dust mite | chitin-binding protein | 0000902012 | AAA78904.1 | 144 | 1161, 4505, 19524, 20169 | 2007 | MKSVLIFLVAIALFSANIVSADEQTTRGRHTEPDDHHEKPTTQCTHEETTSTQHHHEEVV TTQTPHHEEKTTTEETHHSDDLIVHEGGKTYHVVCHEEGPIHIQEMCNKYIICSKSGSLW YITVMPCSIGTKFDPISRNCVLDN | >AAA78904.1 Blo t 12; chitin-binding protein [Blomia tropicalis] | View Edit Delete |
| 1057 | Lepidoglyphus destructor | storage mite | unknown function | 0033943777 | AAQ55550.1 | 143 | 1161, 4505, 19524, 20169 | 2007 | MKSVLIFLVAIALFSANIVSADEQTTRGRHTEPDDHHEKPTTHATHEETTSTQHHHEEVT TQTPHHEEKTTTEETHHSDDLIVHEGGKTYHVVCHEEGPIPHPGNVHKYIICSKSGSLWY ITVMPCSIGTKFDPISRNCVLDN | >AAQ55550.1 unknown function [Lepidoglyphus destructor] | View Edit Delete |
| 2008 | Blomia tropicalis | house dust mite | chitin-binding protein, partial | 0723586656 | 2MFK_A | 69 | 1161, 4505, 19524, 20169 | 2016 | GPLGSDLIVHEGGKTYHVVCHEEGPIPHPGNVHKYIICSKSGSLWYITVMPCSIGTKFDP ISRNCVLDN | >2MFK_A Blo t 12; chitin-binding protein, partial [Blomia tropicalis] | View Edit Delete |