Article
The identification of allergen proteins in sugar beet (Beta vulgaris) pollen causing occupational allergy in greenhouses
Id | 20711 |
---|---|
Pubmed | 18694503 |
Authors
Luoto,S., Lambert,W., Blomqvist,A. and Emanuelsson,C.
Title
The identification of allergen proteins in sugar beet (Beta vulgaris) pollen causing occupational allergy in greenhouses
Journal
Clin Mol Allergy 6, 7 (2008)
Pubmed ID
18694503Related Allergens
Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
---|---|---|---|---|---|---|---|---|---|---|---|
1611 | Beta vulgaris | beet | profilin | 0205829383 | P85984.1 | 23 | 20711 | 2017 | YMVIQGEPGAVIRLGDYLIDQGL | >P85984.1 Beta v 2; profilin [Beta vulgaris] | View Edit Delete |
2274 | Beta vulgaris | beet | Ole e 1-like, partial | COMPARE154 | 11 | 20711 | 2020 | VQGMVYCDTCR | >COMPARE154 Beta v 1; Ole e 1-like, partial [Beta vulgaris] | View Edit Delete | |
2275 | Beta vulgaris | beet | Ole e 1-like, partial | COMPARE155 | 12 | 20711 | 2020 | AEGLYNMLIERD | >COMPARE155 Beta v 1; Ole e 1-like, partial [Beta vulgaris] | View Edit Delete | |
2276 | Beta vulgaris | beet | Ole e 1-like, partial | COMPARE156 | 39 | 20711 | 2020 | DCNEIPTEGWAKPSLKVSLTSNNGEASDIRSANALGFMR | >COMPARE156 Beta v 1; Ole e 1-like, partial [Beta vulgaris] | View Edit Delete |