Article
Cross-reactivity to fish and chicken meat – a new clinical
syndrome
Id | 20803 |
---|---|
Pubmed | 27344988 |
Authors
Kuehn A, Codreanu-Morel F, Lehners-Weber C, Doyen V, Gomez-André SA, Bienvenu F, Fischer J, Ballardini N, van Hage M, Perotin JM, Silcret-Grieu S, Chabane H, Hentges F, Ollert M, Hilger C, Morisset M
Title
Cross-reactivity to fish and chicken meat – a new clinical
syndrome
Journal
Allergy. 2016 Dec;71(12):1772-1781
Pubmed ID
27344988Related Allergens
Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
---|---|---|---|---|---|---|---|---|---|---|---|
2282 | Gallus gallus | chicken | beta-enolase, partial from P07322.3 | COMPARE100 | 10 | 20803 | 2020H_MS | SIQKIHAREI | >COMPARE100 Gal d 9; beta-enolase, partial from P07322.3 [Gallus gallus] | View Edit Delete | |
2468 | Gallus gallus | chicken | aldolase, partial | COMPARE00301 | 11 | 20803 | 2022 | KAAQEEYVKRA | >COMPARE00301 Gal d 10; aldolase, partial [Gallus gallus] | View Edit Delete | |
2467 | Gallus gallus | chicken | aldolase, partial | COMPARE00300 | 15 | 20803 | 2022 | RALQASALRAWAGKK | >COMPARE00300 Gal d 10; aldolase, partial [Gallus gallus] | View Edit Delete | |
2466 | Gallus gallus | chicken | aldolase, partial | COMPARE00299 | 19 | 20803 | 2022 | KKYSPEEIAMATVTALRRT | >COMPARE00299 Gal d 10; aldolase, partial [Gallus gallus] | View Edit Delete | |
2465 | Gallus gallus | chicken | aldolase, partial | COMPARE00298 | 63 | 20803 | 2022 | KKDGADFAKWRCVLKISEHTPTRLAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKH | >COMPARE00298 Gal d 10; aldolase, partial [Gallus gallus] | View Edit Delete | |
2464 | Gallus gallus | chicken | aldolase, partial | COMPARE00297 | 28 | 20803 | 2022 | KVDKGVVPLAGTNGETTTQGLDGLMERC | >COMPARE00297 Gal d 10; aldolase, partial [Gallus gallus] | View Edit Delete | |
2463 | Gallus gallus | chicken | aldolase, partial | COMPARE00296 | 32 | 20803 | 2022 | RVDPCIGGVILFHETLYQKADDGRPFPQVIKS | >COMPARE00296 Gal d 10; aldolase, partial [Gallus gallus] | View Edit Delete | |
2462 | Gallus gallus | chicken | aldolase, partial | COMPARE00295 | 57 | 20803 | 2022 | PHQYPALTPEQKKELHDIAKRIVAPGKGILAADESTGSIAKRLSSVGAENTEENRRW | >COMPARE00295 Gal d 10; aldolase, partial [Gallus gallus] | View Edit Delete | |
2461 | Gallus gallus | chicken | beta-enolase, partial from P07322.3 | COMPARE00294 | 12 | 20803 | 2022 | RIEEALGDKAKF | >COMPARE00294 Gal d 9; beta-enolase, partial from P07322.3 [Gallus gallus] | View Edit Delete | |
2460 | Gallus gallus | chicken | beta-enolase, partial from P07322.3 | COMPARE00293 | 62 | 20803 | 2022 | KVNQIGSVTESIQACKLAQSHGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERL | >COMPARE00293 Gal d 9; beta-enolase, partial from P07322.3 [Gallus gallus] | View Edit Delete | |
2459 | Gallus gallus | chicken | beta-enolase, partial | COMPARE00292 | 40 | 20803 | 2022 | KRIITGEQLGEIYRGFIKDYPVVSIEDPFDQDDWEAWKRF | >COMPARE00292 Gal d 9; beta-enolase, partial [Gallus gallus] | View Edit Delete | |
2458 | Gallus gallus | chicken | beta-enolase, partial | COMPARE00291 | 36 | 20803 | 2022 | KAAIAQAGYTDKVVIGMDVAASEFCRDGRYDLDFKS | >COMPARE00291 Gal d 9; beta-enolase, partial [Gallus gallus] | View Edit Delete | |
2457 | Gallus gallus | chicken | beta-enolase, partial from P07322.3 | COMPARE00290 | 79 | 20803 | 2022 | KAGAAEKGVPLYRHIADLAGNTELILPVPAFNVINGGSHAGNKLAMQEFMVLPVGAASFH DAMRVGAEVYHSLKGVIKA | >COMPARE00290 Gal d 9; beta-enolase, partial from P07322.3 [Gallus gallus] | View Edit Delete | |
2456 | Gallus gallus | chicken | beta-enolase, partial from P07322.3 | COMPARE00289 | 58 | 20803 | 2022 | KAVEHINKTIGPALIEKKISVVEQEKIDKVMIEMDGTENKSKFGANAILGVSLAVCKA | >COMPARE00289 Gal d 9; beta-enolase, partial from P07322.3 [Gallus gallus] | View Edit Delete | |
2455 | Gallus gallus | chicken | beta-enolase, partial | COMPARE00288 | 49 | 20803 | 2022 | REILDSRGNPTVEVDLHTAKGHFRAAVPSGASTGIHEALELRDGDKKRF | >COMPARE00288 Gal d 9; beta-enolase, partial [Gallus gallus] | View Edit Delete |