Article
Purification and molecular characterization of phospholipase, antigen 5 and hyaluronidases from the venom of the Asian hornet (Vespa velutina)
Id | 21081 |
---|---|
Pubmed | 31923175 |
Authors
Rafael I Monsalve, Ruth Gutiérrez, Ilka Hoof, Manuel Lombardero
Title
Purification and molecular characterization of phospholipase, antigen 5 and hyaluronidases from the venom of the Asian hornet (Vespa velutina)
Journal
PLoS One. 2020 Jan 10;15(1):e0225672
Pubmed ID
31923175Related Allergens
Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
---|---|---|---|---|---|---|---|---|---|---|---|
2481 | Vespa velutina | Asian hornet | unknown function, antigen 5, partial from P0DMB9.2 | COMPARE00314 | 100 | 21081, 21082 | 2022 | NTAKYLVGQNIAEQSTTAASFEPVSNMVKMWSDEVKDYQYGSSKNKLNDVGHYTQMVWAK TKEIGCGNIKYIENGWHHHYLVCNYGPAGNIGNEPIYEKK | >COMPARE00314 Vesp v 5; unknown function, antigen 5, partial from P0DMB9.2 [Vespa velutina] | View Edit Delete | |
2480 | Vespa velutina | Asian hornet | unknown function, antigen 5, partial from P0DMB9.2 | COMPARE00313 | 38 | 21081, 21082 | 2022 | GLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCK | >COMPARE00313 Vesp v 5; unknown function, antigen 5, partial from P0DMB9.2 [Vespa velutina] | View Edit Delete | |
2479 | Vespa velutina | Asian hornet | unknown function, antigen 5, partial from P0DMB9.2 | COMPARE00312 | 14 | 21081, 21082 | 2022 | AEKLEILKQHNEFR | >COMPARE00312 Vesp v 5; unknown function, antigen 5, partial from P0DMB9.2 [Vespa velutina] | View Edit Delete | |
2478 | Vespa velutina | Asian hornet | unknown function, antigen 5, partial from P0DMB9.2 | COMPARE00311 | 19 | 21081, 21082 | 2022 | SGIHTLCKYGTSTKPNCGR | >COMPARE00311 Vesp v 5; unknown function, antigen 5, partial from P0DMB9.2 [Vespa velutina] | View Edit Delete | |
2477 | Vespa velutina | Asian hornet | phospholipase A1, partial from C0HLL3.1 | COMPARE00310 | 36 | 21081, 21082 | 2022 | CTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNK | >COMPARE00310 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] | View Edit Delete | |
2476 | Vespa velutina | Asian hornet | phospholipase A1, partial from C0HLL3.1 | COMPARE00309 | 22 | 21081, 21082 | 2022 | AVQYFTECIRHECCLIGVPQSK | >COMPARE00309 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] | View Edit Delete | |
2475 | Vespa velutina | Asian hornet | phospholipase A1, partial from C0HLL3.1 | COMPARE00308 | 22 | 21081, 21082 | 2022 | ICETDAHYVQIIHTSNNLGTER | >COMPARE00308 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] | View Edit Delete | |
2474 | Vespa velutina | Asian hornet | phospholipase A1, partial from C0HLL3.1 | COMPARE00307 | 18 | 21081, 21082 | 2022 | LGKYPEIIGLDPAGPLFK | >COMPARE00307 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] | View Edit Delete | |
2473 | Vespa velutina | Asian hornet | phospholipase A1, partial from C0HLL3.1 | COMPARE00306 | 16 | 21081, 21082 | 2022 | LIGHSLGAQIAGFAGK | >COMPARE00306 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] | View Edit Delete | |
2472 | Vespa velutina | Asian hornet | phospholipase A1, partial from C0HLL3.1 | COMPARE00305 | 12 | 21081, 21082 | 2022 | YIADFSKLLMQK | >COMPARE00305 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] | View Edit Delete | |
2471 | Vespa velutina | Asian hornet | phospholipase A1, partial from C0HLL3.1 | COMPARE00304 | 40 | 21081, 21082 | 2022 | ALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTR | >COMPARE00304 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] | View Edit Delete | |
2470 | Vespa velutina | Asian hornet | phospholipase A1, partial from C0HLL3.1 | COMPARE00303 | 18 | 21081, 21082 | 2022 | NGVFLTLDSLKKGGILNK | >COMPARE00303 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] | View Edit Delete | |
2469 | Vespa velutina | Asian hornet | phospholipase A1, partial from C0HLL3.1 | COMPARE00302 | 13 | 21081, 21082 | 2022 | LVPEQISFILSTR | >COMPARE00302 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina] | View Edit Delete |