Article
Purification and biochemical characterization of Hel a 6, a cross-reactive pectate lyase allergen from Sunflower (Helianthus annuus L.) pollen
| Id | 21128 |
|---|---|
| Pubmed | 33214682 |
Authors
Ghosh, N., Sircar, G., Asam, C., Wolf, M., Hauser, M., Saha, S., Ferreira, F. and Bhattacharya, S. G.
Title
Purification and biochemical characterization of Hel a 6, a cross-reactive pectate lyase allergen from Sunflower (Helianthus annuus L.) pollen
Journal
Sci Rep. 2020 Nov 19; 10(1):20177.
Pubmed ID
33214682Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 3439 | Helianthus annuus | sunflower pollen | pectate lyase, partial from XP_022025296.1 | COMPARE00416 | 44 | 21128 | 2023 | RFGFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFLAPDDAAKK | >COMPARE00416 Hel a 6; pectate lyase, partial from XP_022025296.1 [Helianthus annuus] | View Edit Delete | |
| 3448 | Helianthus annuus | sunflower pollen | pectate lyase, partial from XP_022025296.1 | COMPARE00417 | 14 | 21128 | 2023 | RQAMADCAQGFAKG | >COMPARE00417 Hel a 6; pectate lyase, partial from XP_022025296.1 [Helianthus annuus] | View Edit Delete | |
| 3449 | Helianthus annuus | sunflower pollen | pectate lyase, partial from XP_022025296.1 | COMPARE00418 | 13 | 21128 | 2023 | KQIWIDHCSFSKA | >COMPARE00418 Hel a 6; pectate lyase, partial from XP_022025296.1 [Helianthus annuus] | View Edit Delete | |
| 3450 | Helianthus annuus | sunflower pollen | pectate lyase, partial from XP_022025296.1 | COMPARE00419 | 16 | 21128 | 2023 | KVEITNGGLTLMDVKN | >COMPARE00419 Hel a 6; pectate lyase, partial from XP_022025296.1 [Helianthus annuus] | View Edit Delete | |
| 3451 | Helianthus annuus | sunflower pollen | pectate lyase, partial from XP_022025296.1 | COMPARE00420 | 16 | 21128 | 2023 | KVMLLGADDGHHQDKN | >COMPARE00420 Hel a 6; pectate lyase, partial from XP_022025296.1 [Helianthus annuus] | View Edit Delete | |
| 3452 | Helianthus annuus | sunflower pollen | pectate lyase, partial from XP_022025296.1 | COMPARE00421 | 16 | 21128 | 2023 | RADAPESESMTWNWRT | >COMPARE00421 Hel a 6; pectate lyase, partial from XP_022025296.1 [Helianthus annuus] | View Edit Delete |