Article
Purification and identification of globulin-1 S allele as a novel allergen with N-glycans in wheat (Triticum aestivum)
| Id | 21153 |
|---|---|
| Pubmed | 35576804 |
Authors
Zhu, C., Wang, C., Zhou, J., Wang, Y., Chen, Q. and Fu, L.
Title
Purification and identification of globulin-1 S allele as a novel allergen with N-glycans in wheat (Triticum aestivum)
Journal
Food Chem. 2022 Oct 1; 390(133189.
Pubmed ID
35576804Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 3484 | Triticum aestivum | wheat | cupincin, partial from XP_044383364.1 | COMPARE00628 | 16 | 21153 | 2024 | HGHFKVLERFDHELLR | >COMPARE00628 cupincin, partial from XP_044383364.1 [Triticum aestivum] | View Edit Delete | |
| 3485 | Triticum aestivum | wheat | cupincin, partial from XP_044383364.1 | COMPARE00629 | 16 | 21153 | 2024 | SKGEGEIYEASEEQIR | >COMPARE00629 cupincin, partial from XP_044383364.1 [Triticum aestivum] | View Edit Delete | |
| 3486 | Triticum aestivum | wheat | cupincin, partial from XP_044383364.1 | COMPARE00630 | 20 | 21153 | 2024 | SGGSGRPYHFGQESYREWAK | >COMPARE00630 cupincin, partial from XP_044383364.1 [Triticum aestivum] | View Edit Delete | |
| 3487 | Triticum aestivum | wheat | cupincin, partial from XP_044383364.1 | COMPARE00631 | 26 | 21153 | 2024 | FHQITGDQCHHLRKLDMDVTLVNITR | >COMPARE00631 cupincin, partial from XP_044383364.1 [Triticum aestivum] | View Edit Delete | |
| 3488 | Triticum aestivum | wheat | cupincin, partial from XP_044383364.1 | COMPARE00632 | 27 | 21153 | 2024 | RESFCIREGDVIVIPAGSIVYSANTHR | >COMPARE00632 cupincin, partial from XP_044383364.1 [Triticum aestivum] | View Edit Delete | |
| 3489 | Triticum aestivum | wheat | cupincin, partial from XP_044383364.1 | COMPARE00633 | 36 | 21153 | 2024 | VAYLDAAPRAFLQPSHHDADEIAFVREGEGVLVLLR | >COMPARE00633 cupincin, partial from XP_044383364.1 [Triticum aestivum] | View Edit Delete | |
| 3490 | Triticum aestivum | wheat | cupincin, partial from XP_044383364.1 | COMPARE00634 | 46 | 21153 | 2024 | VVMFINPVSTPGRFQEFFLIGSGDERPQSFLSVFSDEVIQAALNTR | >COMPARE00634 cupincin, partial from XP_044383364.1 [Triticum aestivum] | View Edit Delete |