Article
A recombinant precursor of the mustard allergen Sin a 1 retains the biochemical and immunological features of the heterodimeric native protein.
Id | 2162 |
---|---|
Pubmed | 15785078 |
Authors
Palomares O; Cuesta-Herranz J; Rodriguez R; Villalba M
Title
A recombinant precursor of the mustard allergen Sin a 1 retains the biochemical and immunological features of the heterodimeric native protein.
Journal
Int Arch Allergy Immunol. 2005 May;137(1):18-26
Pubmed ID
15785078Related Allergens
Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
---|---|---|---|---|---|---|---|---|---|---|---|
362 | Sinapis alba | white mustard | 2S albumin, conglutin | 0001009434 | CAA62909.1 | 145 | 135, 199, 2161, 2162, 2449, 7697, 16643 | 2007 | PAGPFGIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQ RPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHLQHVISRIYQTA THLPRVCNIRQVSVCPFQKTMPGPS | >CAA62909.1 Sin a 1; 2S albumin, conglutin [Sinapis alba] | View Edit Delete |
363 | Sinapis alba | white mustard | 2S albumin, conglutin | 0001009436 | CAA62910.1 | 145 | 135, 199, 2161, 2162, 2449, 7697, 16643 | 2007 | PAGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLEGEFDFEDDMENPQGPQQ RPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHLQHVISRIYQTA THLPKVCNIPQVSVCPFKKTMPGPS | >CAA62910.1 Sin a 1; 2S albumin, conglutin [Sinapis alba] | View Edit Delete |
364 | Sinapis alba | white mustard | 2S albumin, conglutin | 0001009438 | CAA62911.1 | 145 | 135, 199, 2161, 2162, 2449, 7697, 16643 | 2007 | PAGPFGIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQ RPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPQVQHVISRIYQTA THLPKVCNIPQVSVCPFKKTMPGPS | >CAA62911.1 Sin a 1; 2S albumin, conglutin [Sinapis alba] | View Edit Delete |
365 | Sinapis alba | white mustard | 2S albumin, conglutin | 0001009440 | CAA62912.1 | 145 | 135, 199, 2161, 2162, 2449, 7697, 16643 | 2007 | PAGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQ RPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHLQHVISRIYQTA THLPKVCNIPQVSVCPFKKTMPGPS | >CAA62912.1 Sin a 1; 2S albumin, conglutin [Sinapis alba] | View Edit Delete |
366 | Sinapis alba | white mustard | 2S albumin, conglutin | 0001009442 | CAA62908.1 | 145 | 135, 199, 2161, 2162, 2449, 7697, 16643 | 2007 | PAGPFGIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQ KPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPQVQHVISRIYQTA THLPKVCNIPQVSVCPFKKTMPGPS | >CAA62908.1 Sin a 1; 2S albumin, conglutin [Sinapis alba] | View Edit Delete |
1158 | Sinapis alba | white mustard | 2S albumin, conglutin | 0051338758 | P15322.2 | 145 | 135, 199, 2161, 2162, 2449, 7697, 16643 | 2007 | PAGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQ RPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPHLQHVISRIYQTA THLPKVCNIRQVSVCPFKKTMPGPS | >P15322.2 Sin a 1; 2S albumin, conglutin [Sinapis alba] | View Edit Delete |