Article
Lipid transfer proteins and allergy to oranges.
| Id | 2185 |
|---|---|
| Pubmed | 15947476 |
Authors
Ahrazem O; Ibanez MD; Lopez-Torrejon G; Sanchez-Monge R; Sastre J; Lombardero M; Barber D; Salcedo G
Title
Lipid transfer proteins and allergy to oranges.
Journal
Int Arch Allergy Immunol. 2005 Jul;137(3):201-10
Pubmed ID
15947476Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 1145 | Citrus sinensis | orange | lipid transfer protein | 0050199132 | CAH03799.1 | 91 | 2184, 2185 | 2007 | ITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPN LNPNNAVGLPRACGVSIPYKISISTDCSKVR | >CAH03799.1 Cit s 3; lipid transfer protein [Citrus sinensis] | View Edit Delete |
| 1162 | Citrus limon | lemon | lipid transfer protein | 0052783176 | P84160.1 | 20 | 2184, 2185 | 2007 | ITCGQVTGSLAPXIPFLRTG | >P84160.1 Cit l 3; lipid transfer protein [Citrus limon] | View Edit Delete |
| 1163 | Citrus sinensis | orange | lipid transfer protein | 0052783177 | P84161.1 | 20 | 2184, 2185 | 2007 | ITXGQVTGSLAPXIAFLRTK | >P84161.1 Cit s 3; lipid transfer protein [Citrus sinensis] | View Edit Delete |