Article
Allergenic reactivity of the melon profilin Cuc m 2 and its identification as major allergen.
| Id | 2193 |
|---|---|
| Pubmed | 16120089 |
Authors
Lopez-Torrejon G; Crespo JF; Sanchez-Monge R; Sanchez-Jimenez M; Alvarez J; Rodriguez J; Salcedo G
Title
Allergenic reactivity of the melon profilin Cuc m 2 and its identification as major allergen.
Journal
Clin Exp Allergy. 2005 Aug;35(8):1065-72
Pubmed ID
16120089Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 1032 | Cucumis melo | muskmelon | profilin | 0031559374 | CAD92666.1 | 131 | 2192, 2193, 2194 | 2007 | MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE RLGDYLIEQGL | >CAD92666.1 profilin [Cucumis melo] | View Edit Delete |
| 1186 | Cucumis melo | muskmelon | profilin | 0057021110 | AAP13533.2 | 131 | 2192, 2193, 2194 | 2007 | MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE RLGDYLIDQGL | >AAP13533.2 Cuc m 2; profilin [Cucumis melo] | View Edit Delete |
| 1189 | Cucumis melo | muskmelon | profilin | 0058263793 | AAW69549.1 | 131 | 2192, 2193, 2194 | 2007 | MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGATVKKTGMALVIGIYDEPMTPGQCNMIVE RLGDYLIDQGL | >AAW69549.1 Cuc m 2; profilin [Cucumis melo] | View Edit Delete |