Article
Cloning and sequencing of a cDNA expressing a recombinant house dust mite protein that binds human IgE and corresponds to an important low molecular weight allergen
| Id | 222 |
|---|---|
| Pubmed | 2794865 |
Authors
Tovey,E.R.; Johnson,M.C.; Roche,A.L.; Cobon,G.S.; Baldo,B.A.
Title
Cloning and sequencing of a cDNA expressing a recombinant house dust mite protein that binds human IgE and corresponds to an important low molecular weight allergen
Journal
J. Exp. Med. 170 (4), 1457-1462 (1989)
Pubmed ID
2794865Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 72 | Dermatophagoides pteronyssinus | house dust mite | unknown function | 0000009072 | CAA35692.1 | 148 | 146, 222, 2511, 7687, 7750, 15149 | 2015 | LFLENKDPKPLKKISIMKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKK GELALFYLQEQINHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQY NLEMAKKSGDILERDLKKEEARVKKIEV | >CAA35692.1 Der p 5; unknown function [Dermatophagoides pteronyssinus] | View Edit Delete |
| 350 | Dermatophagoides pteronyssinus | house dust mite | unknown function | 0000913285 | AAB32842.1 | 132 | 146, 222, 2511, 7687, 7750, 15149 | 2007 | MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFE AKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDL KKEEARVKKIEV | >AAB32842.1 Der p 5; unknown function [Dermatophagoides pteronyssinus] | View Edit Delete |
| 997 | Dermatophagoides pteronyssinus | house dust mite | unknown function | 0028798085 | CAD69036.1 | 132 | 146, 222, 2511, 7687, 7750, 15149 | 2007 | MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFE EKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMLKKSGDILERDL KKEEARVKNIEV | >CAD69036.1 Der p 5; unknown function [Dermatophagoides pteronyssinus] | View Edit Delete |