Article
Immunological and molecular characterization of the major allergens from lilac and privet pollens overproduced in Pichia pastoris.
Id | 2356 |
---|---|
Pubmed | 11251633 |
Authors
Gonzalez E; Villalba M; Rodriguez R
Title
Immunological and molecular characterization of the major allergens from lilac and privet pollens overproduced in Pichia pastoris.
Journal
Clin Exp Allergy. 2001 Feb;31(2):313-21
Pubmed ID
11251633Related Allergens
Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
---|---|---|---|---|---|---|---|---|---|---|---|
321 | Syringa vulgaris | lilac | Ole e 1-like | 0000631911 | S43242 | 145 | 1005, 2356, 2457 | 2007 | EDVPQPPIPQFHIQGQVYCDTCRARFITELSEFIPGASIRLQCKDRENGKITFTEIGYTR AEGLYSMLVEGDHKNEFCEITLISSGREDCDEIPVEGWAKPSLKFKLNTVNGTTRTINPI GFFKKEALPKCTQVYNKLGMYPPNM | >S43242 Syr v 1; Ole e 1-like [Syringa vulgaris] | View Edit Delete |
322 | Syringa vulgaris | lilac | Ole e 1-like | 0000631912 | S43243 | 145 | 1005, 2356, 2457 | 2007 | EDVPQPPVPQFHIQGQVYCDTCRARFITELSEFIPGAGIRLQCKDGEHGKITFTEIGYTR AEGLYSMLVEGDHKNEFCEITLLSSSRKDCEEIPIEGWVKPSLKFILNTVNGTTRTINPL GFFKKEVLPKCPQVFNKLGMYPPNM | >S43243 Syr v 1; Ole e 1-like [Syringa vulgaris] | View Edit Delete |
323 | Syringa vulgaris | lilac | Ole e 1-like | 0000631913 | S43244 | 145 | 1005, 2356, 2457 | 2007 | EDVPQPPVPQFHIQGQVYCDTCRARFITELSEFIPGASIRLQCKDGENGKITFTEIGYTR AEGLYSMLVEGDHKNEFCEITLISSGRKDCDEIPVEGWVKPSLKFKLNTVNGTTRTINPI GFFKKEALPKCTQVYNKLGMYPPNM | >S43244 Syr v 1; Ole e 1-like [Syringa vulgaris] | View Edit Delete |