Article
Parietaria profilin shows only limited cross-reactivity with birch and grass profilins.
| Id | 2412 |
|---|---|
| Pubmed | 14739580 |
Authors
Asero R; Mistrello G; Roncarolo D; Amato S
Title
Parietaria profilin shows only limited cross-reactivity with birch and grass profilins.
Journal
Int Arch Allergy Immunol. 2004 Feb;133(2):121-4
Pubmed ID
14739580Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 823 | Parietaria judaica | pellitory | profilin | 0014423869 | Q9T0M8.1 | 131 | 2265, 2411, 2412, 2413 | 2007 | MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF LAPTGLFLGGTKYMVIQGESGAVIGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVVE RLGDYLLEQGM | >Q9T0M8.1 Par j 3; profilin [Parietaria judaica] | View Edit Delete |
| 824 | Parietaria judaica | pellitory | profilin | 0014423876 | Q9XG85.1 | 132 | 2265, 2411, 2412, 2413 | 2007 | MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV ERLGDYLLEQGL | >Q9XG85.1 Par j 3; profilin [Parietaria judaica] | View Edit Delete |
| 1916 | Parietaria judaica | pellitory | profilin | 0444175753 | CCP19647.1 | 131 | 2265, 2411, 2412, 2413 | 2014 | MSWQTYVDDHLMCEIEGNHLTAAAILGQDGSVWAQSASFPQFKPEEIAAIVKDFEEPGTL APTGLFLGGAKYMVIQGEAGVVIRGKKGSGGVTVKKTGQALVIGIYDEPMAPGQCNMIVE RLGDYLIETGL | >CCP19647.1 Par j 3; profilin [Parietaria judaica] | View Edit Delete |