Article
Cloning of cDNA and chromosomal location of genes encoding the three types of subunits of the wheat tetrameric inhibitor of insect alpha-amylase
| Id | 243 |
|---|---|
| Pubmed | 2102861 |
Authors
Garcia-Maroto,F.; Marana,C.; Mena,M.; Garcia-Olmedo,F.; Carbonero,P.
Title
Cloning of cDNA and chromosomal location of genes encoding the three types of subunits of the wheat tetrameric inhibitor of insect alpha-amylase
Journal
Plant Mol. Biol. 14 (5), 845-853 (1990)
Pubmed ID
2102861Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 94 | Triticum aestivum | wheat | alpha-amylase inhibitor | 0000021701 | CAA35598.1 | 145 | 243, 1166, 2234 | 2007 | MASKSSISPLLLATVLVSVFAAATATGPYCYAGMGLPINPLEGCREYVAQQTCGISISGS AVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFA KVLVTSGHCNVMTVHNAPYCLGLDI | >CAA35598.1 Tri a 29; alpha-amylase inhibitor [Triticum aestivum] | View Edit Delete |
| 96 | Triticum aestivum | wheat | alpha-amylase inhibitor | 0000021713 | CAA35597.1 | 168 | 243, 2234, 2467 | 2007 | MACKSSCSLLLLAAVLLSVLAAASASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSK LPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVG ESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI | >CAA35597.1 Tri a 30; alpha-amylase inhibitor [Triticum aestivum] | View Edit Delete |
| 108 | Triticum turgidum | wheat | alpha-amlyase inhibitor | 0000021920 | CAA39099.1 | 145 | 243, 1166, 2234 | 2007 | MASKSSITHLLLAAVLVSVFAAAAATGPYCYPGMGLPSNPLEGCREYVAQQTCGVGIVGS PVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRTSDPNSGVLKDLPGCPREPQRDFA KVLVTPGHCNVMTVHNTPYCLGLDI | >CAA39099.1 alpha-amlyase inhibitor [Triticum turgidum] | View Edit Delete |
| 1684 | Triticum aestivum | wheat | alpha-amylase inhibitor | 0253783731 | CAZ76052.1 | 120 | 243, 1166, 2234 | 2011 | TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLDI | >CAZ76052.1 Tri a 29; alpha-amylase inhibitor [Triticum aestivum] | View Edit Delete |
| 1702 | Triticum aestivum | wheat | alpha-amylase inhibitor | 0283465827 | CBA13559.1 | 120 | 243, 1166, 2234 | 2011 | TGPYCYPGMGLPSNPLEGCREYVAQQTCGVGIVGSPVSTEPGNTPRDRCCKELYDASQHC WCEAVRYFIGRTSDPNSGVLKDLPGCPREPQRDSAKVLVTPGHCNVMTVHNTPYCLGLDI | >CBA13559.1 Tri a 29; alpha-amylase inhibitor [Triticum aestivum] | View Edit Delete |