Article
Identification and localization of allergenic determinants on grass group I antigens using monoclonal antibodies.
| Id | 2443 |
|---|---|
| Pubmed | 2462587 |
Authors
Esch RE; Klapper DG
Title
Identification and localization of allergenic determinants on grass group I antigens using monoclonal antibodies.
Journal
J Immunol. 1989 Jan 1;142(1):179-84
Pubmed ID
2462587Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 245 | Schedonorus arundinaceus | tall fescue | beta-expansin, partial | 0000320610 | C37396 | 17 | 1001, 2038, 2443 | 2007 | YTTEGGTKSEAEDVIPE | >C37396 beta-expansin, partial [Schedonorus arundinaceus] | View Edit Delete |
| 246 | Schedonorus arundinaceus | tall fescue | beta-expansin, partial | 0000320611 | D37396 | 20 | 1001, 2038, 2443 | 2007 | YTTEGGTKSEVEDVIPEGWK | >D37396 beta-expansin, partial [Schedonorus arundinaceus] | View Edit Delete |
| 1273 | Schedonorus arundinaceus | tall fescue | beta-expansin, partial | 0075139991 | Q7M1Y1 | 35 | 1001, 2038, 2443 | 2007 | IAKVPPGPNITAEYGDKWLDAKSTFYGKPTGAGPK | >Q7M1Y1 beta-expansin, partial [Schedonorus arundinaceus] | View Edit Delete |