Article
Primary structure of the major allergen of yellow mustard (Sinapis alba L.) seed, Sin a I.
| Id | 2449 |
|---|---|
| Pubmed | 3181153 |
Authors
Menendez-Arias L; Moneo I; Dominguez J; Rodriguez R
Title
Primary structure of the major allergen of yellow mustard (Sinapis alba L.) seed, Sin a I.
Journal
Eur J Biochem. 1988 Oct 15;177(1):159-66
Pubmed ID
3181153Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 362 | Sinapis alba | white mustard | 2S albumin, conglutin | 0001009434 | CAA62909.1 | 145 | 135, 199, 2161, 2162, 2449, 7697, 16643 | 2007 | PAGPFGIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQ RPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHLQHVISRIYQTA THLPRVCNIRQVSVCPFQKTMPGPS | >CAA62909.1 Sin a 1; 2S albumin, conglutin [Sinapis alba] | View Edit Delete |
| 363 | Sinapis alba | white mustard | 2S albumin, conglutin | 0001009436 | CAA62910.1 | 145 | 135, 199, 2161, 2162, 2449, 7697, 16643 | 2007 | PAGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLEGEFDFEDDMENPQGPQQ RPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHLQHVISRIYQTA THLPKVCNIPQVSVCPFKKTMPGPS | >CAA62910.1 Sin a 1; 2S albumin, conglutin [Sinapis alba] | View Edit Delete |
| 364 | Sinapis alba | white mustard | 2S albumin, conglutin | 0001009438 | CAA62911.1 | 145 | 135, 199, 2161, 2162, 2449, 7697, 16643 | 2007 | PAGPFGIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQ RPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPQVQHVISRIYQTA THLPKVCNIPQVSVCPFKKTMPGPS | >CAA62911.1 Sin a 1; 2S albumin, conglutin [Sinapis alba] | View Edit Delete |
| 365 | Sinapis alba | white mustard | 2S albumin, conglutin | 0001009440 | CAA62912.1 | 145 | 135, 199, 2161, 2162, 2449, 7697, 16643 | 2007 | PAGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQ RPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHLQHVISRIYQTA THLPKVCNIPQVSVCPFKKTMPGPS | >CAA62912.1 Sin a 1; 2S albumin, conglutin [Sinapis alba] | View Edit Delete |
| 366 | Sinapis alba | white mustard | 2S albumin, conglutin | 0001009442 | CAA62908.1 | 145 | 135, 199, 2161, 2162, 2449, 7697, 16643 | 2007 | PAGPFGIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQ KPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPQVQHVISRIYQTA THLPKVCNIPQVSVCPFKKTMPGPS | >CAA62908.1 Sin a 1; 2S albumin, conglutin [Sinapis alba] | View Edit Delete |
| 1158 | Sinapis alba | white mustard | 2S albumin, conglutin | 0051338758 | P15322.2 | 145 | 135, 199, 2161, 2162, 2449, 7697, 16643 | 2007 | PAGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQ RPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPHLQHVISRIYQTA THLPKVCNIRQVSVCPFKKTMPGPS | >P15322.2 Sin a 1; 2S albumin, conglutin [Sinapis alba] | View Edit Delete |