Article
Wheat and maize thioredoxins: a novel cross-reactive cereal allergen family related to baker
| Id | 3158 |
|---|---|
| Pubmed | 16522470 |
Authors
Weichel M; Glaser AG; Ballmer-Weber BK; Schmid-Grendelmeier P; Crameri R
Title
Wheat and maize thioredoxins: a novel cross-reactive cereal allergen family related to baker
Journal
J Allergy Clin Immunol. 2006 Mar;117(3):676-81
Pubmed ID
16522470Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 755 | Triticum aestivum | wheat | thioredoxin | 0008980491 | CAB96931.1 | 125 | 3158, 18607 | 2015 | MAASAATATAAAVGAGEVISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIF ADLAKKFPAAVFLKVDVDELKSIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTNKVG LHAAQ | >CAB96931.1 Tri a 25; thioredoxin [Triticum aestivum] | View Edit Delete |
| 1235 | Zea mays | corn | thioredoxin | 0066841002 | CAI64400.1 | 128 | 3158, 19185, 19186 | 2007 | MAASEAAAAAATPVAPTEGTVIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMA PIFADMAKKSPNVVFLKVDVDEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELAR KLELHMAS | >CAI64400.1 Zea m 25; thioredoxin [Zea mays] | View Edit Delete |
| 1236 | Triticum aestivum | wheat | alpha-amylase inhibitor | 0066841026 | CAI84642.1 | 119 | 3158, 18607, 19761, 19762 | 2007 | CYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMY KEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA | >CAI84642.1 Tri a 28; alpha-amylase inhibitor [Triticum aestivum] | View Edit Delete |