Article
Genomics of Aspergillus fumigatus.
| Id | 4496 |
|---|---|
| Pubmed | 16499415 |
Authors
Ronning CM; Fedorova ND; Bowyer P; Coulson R; Goldman G; Kim HS; Turner G; Wortman JR; Yu J; Anderson MJ; Denning DW; Nierman WC
Title
Genomics of Aspergillus fumigatus.
Journal
Rev Iberoam Micol. 2005 Dec;22(4):223-8
Pubmed ID
16499415Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 578 | Aspergillus fumigatus | fungus | ribonuclease mitogillin, partial | 0003021324 | CAA06305.1 | 125 | 75, 198, 887, 1270, 2118, 4496, 19419 | 2007 | RLVYNQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGDGKLIKGRMPIKFGKADCDRPPK HGKDGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHERGN QGDLR | >CAA06305.1 Asp f 1; ribonuclease mitogillin, partial [Aspergillus fumigatus] | View Edit Delete |
| 757 | Aspergillus fumigatus | fungus | ribonuclease mitogillin | 0009280360 | AAF86369.1 | 150 | 75, 198, 887, 1270, 2118, 4496, 19419 | 2007 | MTWTCINQQLNPKTNKWEDKRLLYNQAKAESNSHHAPLSDGKTGSSYAHWFTNGYDGNGK LIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKNKPKEDPGPA RVIYTYPNKVFCGIVAHQRGNEGDLRLCSH | >AAF86369.1 Asp f 1; ribonuclease mitogillin [Aspergillus fumigatus] | View Edit Delete |
| 1164 | Aspergillus fumigatus | fungus | ribonuclease mitogillin | 0054039254 | P67875.1 | 176 | 75, 198, 887, 1270, 2118, 4496, 19419 | 2007 | MVAIKNLFLLAATAVSVLAAPSPLDARATWTCINQQLNPKTNKWEDKRLLYSQAKAESNS HHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYL LEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH | >P67875.1 Asp f 1; ribonuclease mitogillin [Aspergillus fumigatus] | View Edit Delete |