Allergen

2206305A

Accession 2206305A
Species Myrmecia pilosula
Common Name Jumper ant
Description major allergen Myr p II
IUIS Name
Gi 0001587177
Length 75
Year Adopted 2007
Sequence >2206305A Putative major allergen Myr p II [Myrmecia pilosula]
MKLSCLLLTLAIIFVLTIVHAPNVEAKALADPESDAVGFADAVGGADPIDWKKVDWKKVS
KKTCKVMLKACKFLG
Parent Accession