Allergen

AAB36316.1

Accession AAB36316.1
Species Myrmecia pilosula
Common Name Jumper ant
Description pilosulin
IUIS Name Myr p 2
Gi 0001438761
Length 75
Year Adopted 2010
Sequence >AAB36316.1 Allergen Myr p 2; pilosulin [Myrmecia pilosula]
MKLSCLLLTLAIIFVLTIVHAPNVEAKALADPESDAVGFADAVGEADPIDWKKVDWKKVS
KKTCKVMLKACKFLG
Parent Accession