Powered by FoodRisk.org

Allergen

P80198.1

Accession P80198.1
Species Hordeum vulgare
Common Name Barley
Description Gamma-hordein-3
IUIS Name Hor v 20
Gi 0001708280
Length 289
Year Adopted 2015
Sequence >P80198.1 Allergen Hor v 20; gamma-hordein-3 [Hordeum vulgare]
ITTTTMQFNPSGLELERPQQLFPQWQPLPQQPPFLQQEPEQPYPQQQPLPQQQPFPQQPQ
LPHQHQFPQQLPQQQFPQQMPLQPQQQFPQQMPLQPQQQPQFPQQKPFGQYQQPLTQQPY
PQQQPLAQQQPSIEEQHQLNLCKEFLLQQCTLDEKVPLLQSVISFLRPHISQQNSCQLKR
QQCCQQLANINEQSRCPAIQTIVHAIVMQQQVQQQVGHGFVQSQLQQLGQGMPIQLQQQP
GQAFVLPQQQAQFKVVGSLVIQTLPMLCNVHVPPYCSPFGSMATGSGGQ
Parent Accession