Allergen

AAA33947.1

Accession AAA33947.1
Species Glycine max
Common Name soybean
Description 7S globulin, vicilin, beta-conglycinin
IUIS Name Gly m 5
Gi 0000169927
Length 218
Year Adopted 2007
Sequence >AAA33947.1 Gly m 5; 7S globulin, vicilin, beta-conglycinin [Glycine max]
SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE
GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV
IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE
KLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY
Parent Accession