Allergen

AAN86249.1

Accession AAN86249.1
Species Brassica napus
Common Name rape
Description 2S albumin, conglutin
IUIS Name Bra n 1
Gi 0026985163
Length 109
Year Adopted 2007
Sequence >AAN86249.1 Bra n 1; 2S albumin, conglutin [Brassica napus]
QPQKCQREFQQEQHLRACQQWIRQQLAGSPFSENQWGPQQGPSLREQCCNELYQEDQVCV
CPTLKQAAKSVRVQGQHGPFQSTRIYQIAKNLPNVCNMKQIGTCPFIAI
Parent Accession

Related Articles

Pubmed Authors Title Journal
12027892 Palomares O; Monsalve RI; Rodriguez R; Villalba M Recombinant pronapin precursor produced in Pichia pastoris displays structural and immunologic equivalent properties to its mature product isolated from rapeseed. Eur J Biochem. 2002 May;269(10):2538-45
9249277 Monsalve RI; Gonzalez de la Pena MA; Lopez-Otin C; Fiandor A; Fernandez C; Villalba M; Rodriguez R Detection, isolation and complete amino acid sequence of an aeroallergenic protein from rapeseed flour. Clin Exp Allergy. 1997 Jul;27(7):833-41
16461144 Puumalainen TJ; Poikonen S; Kotovuori A; Vaali K; Kalkkinen N; Reunala T; Turjanmaa K; Palosuo T Napins, 2S albumins, are major allergens in oilseed rape and turnip rape. J Allergy Clin Immunol. 2006 Feb;117(2):426-32
18775058 Poikonen S; Rancé F; Puumalainen T; Le Manach G; Reunala T; Turjanmaa K Sensitization and allergy to turnip rape: a comparison between the Finnish and French children with atopic dermatitis. Acta Paediatr. 2008 Sep 4;