Allergen

COMPARE00247

Accession COMPARE00247
Species Felis catus
Common Name cat
Description NPC2-like protein, partial
IUIS Name
Gi
Length 130
Year Adopted 2022
Sequence >COMPARE00247 NPC2-like protein, partial [Felis catus]
EPVIFKDCGSGFGVIKELNVSPCPTQPCKLHKGQSYSVNVTFTSNVSSQGSKALVYGILM
GVAVPFPIPEADGCKSGINCPIQQGKTYSYLNKLPVKNEYPSIKVMVKWQLLGDKEQNLF
CWEIPVQIEG
Parent Accession XP_003987882.1