Allergen

COMPARE00289

Accession COMPARE00289
Species Gallus gallus
Common Name chicken
Description beta-enolase, partial
IUIS Name Gal d 9
Gi
Length 58
Year Adopted 2022
Sequence >COMPARE00289 Allergen Gal d 9; beta-enolase, partial [Gallus gallus]
KAVEHINKTIGPALIEKKISVVEQEKIDKVMIEMDGTENKSKFGANAILGVSLAVCKA
Parent Accession P07322