Allergen

COMPARE00290

Accession COMPARE00290
Species Gallus gallus
Common Name chicken
Description beta-enolase, partial
IUIS Name Gal d 9
Gi
Length 79
Year Adopted 2022
Sequence >COMPARE00290 Allergen Gal d 9; beta-enolase, partial [Gallus gallus]
KAGAAEKGVPLYRHIADLAGNTELILPVPAFNVINGGSHAGNKLAMQEFMVLPVGAASFH
DAMRVGAEVYHSLKGVIKA
Parent Accession P07322