Allergen

COMPARE00293

Accession COMPARE00293
External DB Link
Species Gallus gallus
Common Name chicken
Description beta-enolase, partial from P07322.3
IUIS Name Gal d 9
Length 62
Year Adopted 2022
Sequence >COMPARE00293 Gal d 9; beta-enolase, partial from P07322.3 [Gallus gallus]
KVNQIGSVTESIQACKLAQSHGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERL
Parent Accession P07322.3

Related Sequences

Peptide sequences mapped to Parent Accession

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.