Allergen

COMPARE00296

Accession COMPARE00296
Species Gallus gallus
Common Name chicken
Description aldolase, partial
IUIS Name Gal d 10
Gi
Length 32
Year Adopted 2022
Sequence >COMPARE00296 Allergen Gal d 10; aldolase, partial [Gallus gallus]
RVDPCIGGVILFHETLYQKADDGRPFPQVIKS
Parent Accession