Allergen

COMPARE00304

Accession COMPARE00304
External DB Link
Species Vespa velutina
Common Name Asian hornet
Description phospholipase A1, partial from C0HLL3.1
IUIS Name Vesp v 1
Length 40
Year Adopted 2022
Sequence >COMPARE00304 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina]
ALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTR
Parent Accession C0HLL3.1

Related Sequences

Peptide sequences mapped to Parent Accession

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.