Allergen

COMPARE00304

Accession COMPARE00304
Species Vespa velutina
Common Name Asian hornet
Description phospholipase A1, partial
IUIS Name Vesp v 1
Gi
Length 40
Year Adopted 2022
Sequence >COMPARE00304 Allergen Vesp v 1; phospholipase A1, partial [Vespa velutina]
ALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTR
Parent Accession C0HLL3