Allergen

COMPARE00310

Accession COMPARE00310
Species Vespa velutina
Common Name Asian hornet
Description phospholipase A1, partial
IUIS Name Vesp v 1
Gi
Length 36
Year Adopted 2022
Sequence >COMPARE00310 Allergen Vesp v 1; phospholipase A1, partial [Vespa velutina]
CTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNK
Parent Accession C0HLL3