Allergen

COMPARE00310

Accession COMPARE00310
Species Vespa velutina
Common Name Asian hornet
Description phospholipase A1, partial from C0HLL3.1
IUIS Name Vesp v 1
Gi
Length 36
Year Adopted 2022
Sequence >COMPARE00310 Vesp v 1; phospholipase A1, partial from C0HLL3.1 [Vespa velutina]
CTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNK
Parent Accession C0HLL3.1

Related Articles

Pubmed Authors Title Journal
31923175 Rafael I Monsalve, Ruth Gutiérrez, Ilka Hoof, Manuel Lombardero Purification and molecular characterization of phospholipase, antigen 5 and hyaluronidases from the venom of the Asian hornet (Vespa velutina) PLoS One. 2020 Jan 10;15(1):e0225672
32043465 C Vidal, M Armisen, R Monsalve, T Gonzalez-Vidal, S Lojo, S Lopez-Freire, P Mendez, V Rodriguez, L Romero, A Galan, A Gonzalez-Quintela Anaphylaxis to Vespa velutina nigrithorax: pattern of sensitization for an emerging problem in Western countries. J Investig Allergol Clin Immunol . 2021 Jun 22;31(3):228-235.