Allergen

COMPARE00313

Accession COMPARE00313
Species Vespa velutina
Common Name Asian hornet
Description unknown function, antigen 5, partial
IUIS Name Vesp v 5
Gi
Length 38
Year Adopted 2022
Sequence >COMPARE00313 Allergen Vesp v 5; unknown function, antigen 5, partial [Vespa velutina]
GLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCK
Parent Accession P0DMB9