Allergen

COMPARE00314

Accession COMPARE00314
External DB Link
Species Vespa velutina
Common Name Asian hornet
Description unknown function, antigen 5, partial from P0DMB9.2
IUIS Name Vesp v 5
Length 100
Year Adopted 2022
Sequence >COMPARE00314 Vesp v 5; unknown function, antigen 5, partial from P0DMB9.2 [Vespa velutina]
NTAKYLVGQNIAEQSTTAASFEPVSNMVKMWSDEVKDYQYGSSKNKLNDVGHYTQMVWAK
TKEIGCGNIKYIENGWHHHYLVCNYGPAGNIGNEPIYEKK
Parent Accession P0DMB9.2

Related Sequences

Peptide sequences mapped to Parent Accession

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.