Allergen

COMPARE00416

Accession COMPARE00416
External DB Link
Species Helianthus annuus
Common Name sunflower pollen
Description pectate lyase, partial from XP_022025296.1
IUIS Name Hel a 6
Length 44
Year Adopted 2023
Sequence >COMPARE00416 Hel a 6; pectate lyase, partial from XP_022025296.1 [Helianthus annuus]
RFGFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFLAPDDAAKK
Parent Accession XP_022025296.1

Related Sequences

Peptide sequences mapped to Parent Accession

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.