Allergen

2MFK_A

Accession 2MFK_A
External DB Link NCBI Protein
Species Blomia tropicalis
Common Name house dust mite
Description chitin-binding protein, partial
IUIS Name Blo t 12
Length 69
Year Adopted 2016
Sequence >2MFK_A Blo t 12; chitin-binding protein, partial [Blomia tropicalis]
GPLGSDLIVHEGGKTYHVVCHEEGPIPHPGNVHKYIICSKSGSLWYITVMPCSIGTKFDP
ISRNCVLDN
Parent Accession

Related Articles

Pubmed Authors Title Journal
8939156 Puerta,L.; Caraballo,L.; Fernandez-Caldas,E.; Avjioglu,A.; Marsh,D.G.; Lockey,R.F.; Dao,M.L. Nucleotide sequence analysis of a complementary DNA coding for a Blomia tropicalis allergen J. Allergy Clin. Immunol. 98 (5 Pt 1), 932-937 (1996)
17504089 Chua KY; Cheong N; Kuo IC; Lee BW; Yi FC; Huang CH; Liew LN The Blomia tropicalis allergens. Protein Pept Lett. 2007;14(4):325-33
19226278 Zakzuk J; Jiménez S; Cheong N; Puerta L; Lee BW; Chua KY; Caraballo L Immunological characterization of a Blo t 12 isoallergen: identification of immunoglobulin E epitopes. Clin Exp Allergy. 2009 Apr;39(4):608-16
10697258 Yi FC; Chew FT; Jimenez S; Chua KY; Lee BW Culture of Blomia tropicalis and IgE immunoblot characterization of its allergenicity. Asian Pac J Allergy Immunol. 1999 Sep;17(3):189-94