Allergen

CAI84642.1

Accession CAI84642.1
External DB Link NCBI Protein
Species Triticum aestivum
Common Name wheat
Description alpha-amylase inhibitor
IUIS Name Tri a 28
Length 119
Year Adopted 2007
Sequence >CAI84642.1 Tri a 28; alpha-amylase inhibitor [Triticum aestivum]
CYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMY
KEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA
Parent Accession

Related Articles

Pubmed Authors Title Journal
16522470 Weichel M; Glaser AG; Ballmer-Weber BK; Schmid-Grendelmeier P; Crameri R Wheat and maize thioredoxins: a novel cross-reactive cereal allergen family related to baker J Allergy Clin Immunol. 2006 Mar;117(3):676-81
21557753 Sander I; Rozynek P; Rihs HP; van Kampen V; Chew FT; Lee WS; Kotschy-Lang N; Merget R; Brüning T; Raulf-Heimsoth M Multiple wheat flour allergens and cross-reactive carbohydrate determinants bind IgE in baker Allergy. 2011 Sep;66(9):1208-15
17496422 Pastorello EA; Farioli L; Conti A; Pravettoni V; Bonomi S; Iametti S; Fortunato D; Scibilia J; Bindslev-Jensen C; Ballmer-Weber B; Robino AM; Ortolani C Wheat IgE-mediated food allergy in European patients: alpha-amylase inhibitors, lipid transfer proteins and low-molecular-weight glutenins. Allergenic molecules recognized by double-blind, placebo-controlled food challenge. Int Arch Allergy Immunol. 2007;144(1):10-22
18340628 Sotkovský P; Hubálek M; Hernychová L; Novák P; Havranová M; Setinová I; Kitanovicová A; Fuchs M; Stulík J; Tucková L Proteomic analysis of wheat proteins recognized by IgE antibodies of allergic patients. Proteomics. 2008 Apr;8(8):1677-91